Product Details
Place of Origin: China
Document: Product Brochure PDF
Payment & Shipping Terms
Minimum Order Quantity: 10vials
Price: USD
Packaging Details: 1kg/Foil Bag
Delivery Time: 3-7days after received payment
Payment Terms: T/T, Western Union,PayPal
Supply Ability: 5000KG Per Year
Product Name: |
Adipotide |
Purity: |
99% |
Appearance: |
Freeze Dried Powder |
Usage: |
Bodybuilding |
Specification: |
2mg |
Product Name: |
Adipotide |
Purity: |
99% |
Appearance: |
Freeze Dried Powder |
Usage: |
Bodybuilding |
Specification: |
2mg |
Hot Sale 99% High Purity Semaglutide Peptides Vial Adipotide Raw Powder
PNC-27 is an anticancer peptide, containing an HDM-2-binding domain. PNC-27 shows anti-tumor activity and can be used in acute myeloid leukemia research.
CAS | 1159861-00-3 |
M.W/Mr. | 4029.2 |
Purity | 99% |
Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
Note: Due to policy changes, some products have not been disclosed on here. However, you can still ask us for quotations via email, phone, WhatsApp and WeChat.
If you couldn't find the product you want in our store, maybe we haven't uploaded the complete product, please feel free to contact us through various ways; if you want to customize and process the product you want, please feel free to contact us for more details too.
1.How to get in touch with us?
You can chat with us by Trademanager,WhatsApp or simply giving us an email, a phone call. All our contacts information can be found from our website.
2.Are you a manufacturer or trade company?
We are a professional manufacturer.
3.Can I get a sample?
Yes, free sample can be provided, but shipping cost is covered by your side.
4.What's your MOQ?
It is based on the different product. Some are 1g while some are 1 kg. Please be free to consult our salesman.
5.When can I get the quotation?
We usually quote within 1 hours after we get your inquiry. If it's a urgent order you can call us or mention it in your email subject, and we can take it as priority.
6.Is there any discount?
Yes, some products are applied for discount, but it depends on the quantity.
7.Can you do OEM for me?
Yes,we accept OEM orders, just contact us and give us your requirement. We will offer you a reasonable price and make samples ASAP.